1gkg

From PDBWiki

Authors	Smith, B.O. Mallin, R.L. Krych-Goldberg, M. Wang, X. Hauhart, R.E. Bromek, K. Uhrin, D. Atkinson, J.P. Barlow, P.N.
Citation	Structure of the C3b binding site of CR1 (CD35), the immune adherence receptor. PubMed
Release date	2003-04-01
Exp. Method	NMR
Resolution	0.0 Å
Classification	COMPLEMENT

Sequence

Chain A (136 residues): Blast Uniprot

EAEAKSCKTPPDPVNGMVHVITDIQVGSRITYSCTTGHRLIGHSSAECILSGNTAHWSTKPPICQRIPCGLPPTIANGDF
ISTNRENFHYGSVVTYRCNLGSRGRKVFELVGEPSIYCTSNDDQVGIWSGPAPQCI

User comments

Splice variants

This is one of the few examples where structures for different transcripts of the same protein are available:

ensembl transcript id	uniprot id	pdb code
ENST00000367051	CR1_HUMAN	1gkg
ENST00000367051	CR1_HUMAN	1gkn
ENST00000367051	CR1_HUMAN	1gop
ENST00000367051	CR1_HUMAN	1ppq
ENST00000367053	CR1_HUMAN	2q7z

See also [1]

• add comment

Links