1k8b

NMR Structure Analysis of the N-terminal Domain of Archaeal Translation Initiation Factor 2 Subunit beta

Authors	Cho, S. Hoffman, D.W.
Citation	Structure of the beta subunit of translation initiation factor 2 from the archaeon Methanococcus jannaschii: a representative of the eIF2beta/eIF5 family of proteins. PubMed
Release date	2002-08-28
Exp. Method	NMR
Resolution	0.0 Å
Classification	TRANSLATION

Sequence

Chain A (52 residues): Blast Uniprot

EILIEGNRTIIRNFRELAKAVNRDEEFFAKYLLKETGSAGNLEGGRLILQRR