1lmr

Solution of ADO1, a Toxin from the Assassin Bugs Agriosphodrus dohrni that Blocks the Voltage Sensitive Calcium Channel L-type

Authors	Bernard, C. Corzo, G. Adachi-Akahane, S. Foures, G. Kanemaru, K. Furukawa, Y. Nakajima, T. Darbon, H.
Citation	Solution structure of ADO1, a toxin extracted from the saliva of the assassin bug, Agriosphodrus dohrni PubMed
Release date	2004-01-20
Exp. Method	NMR
Resolution	0.0 Å
Classification	TOXIN

Sequence

Chain A (35 residues): Blast Uniprot

ADDDCLPRGSKCLGENKQCCKGTTCMFYANRCVGV