1ppq

From PDBWiki

Authors	O'Leary, J.M. Bromek, K. Black, G.M. Uhrinova, S. Schmitz, C. Wang, X. Krych, M. Atkinson, J.P. Uhrin, D. Barlow, P.N.
Citation	Backbone dynamics of complement control protein (CCP) modules reveals mobility in binding surfaces. PubMed
Release date	2004-05-04
Exp. Method	NMR
Resolution	0.0 Å
Classification	IMMUNE SYSTEM

Sequence

Chain A (68 residues): Blast Uniprot

EAEAKSCKTPPDPVNGMVHVITDIQVGSRITYSCTTGHRLIGHSSAECILSGNTAHWSTKPPICQRIP

User comments

Splice variants

This is one of the few examples where structures for different transcripts of the same protein are available:

ensembl transcript id	uniprot id	pdb code
ENST00000367051	CR1_HUMAN	1gkg
ENST00000367051	CR1_HUMAN	1gkn
ENST00000367051	CR1_HUMAN	1gop
ENST00000367051	CR1_HUMAN	1ppq
ENST00000367053	CR1_HUMAN	2q7z

See also [1]

• add comment

Links