1pqs

Solution structure of the C-terminal OPCA domain of yCdc24p

Authors	Leitner, D. Wahl, M. Labudde, D. Krause, G. Diehl, A. Schmieder, P. Pires, J.R. Fossi, M. Wiedemann, U. Leidert, M. Oschkinat, H.
Citation	The solution structure of an N-terminally truncated version of the yeast CDC24p PB1 domain shows a different beta-sheet topology. PubMed
Release date	2003-07-01
Exp. Method	NMR
Resolution	0.0 Å
Classification	CELL CYCLE

Sequence

Chain A (77 residues): Blast Uniprot

SEIFTLLVEKVWNFDDLIMAINSKISNTHNNNISPITKIKYQDEDGDFVVLGSDEDWNVAKEMLAENNEKFLNIRLY