1tg4
From PDBWiki
Design of specific inhibitors of groupII phospholipase A2(PLA2): Crystal structure of the complex formed between russells viper PLA2 and designed peptide Phe-Leu-Ala-Tyr-Lys at 1.7A resolution
| Authors | Singh, N. Somvanshi, R.K. Sharma, S. Dey, S. Perbandt, M. Betzel, C. Ethayathulla, A.S. Singh, T.P. |
| Citation | Design of specific inhibitors of groupII phospholipase A2(PLA2): Crystal structure of the complex formed between russells viper PLA2 and designed peptide Phe-Leu-Ala-Tyr-Lys at 1.7A resolution |
| Release date | 2004-06-29 |
| Exp. Method | X-RAY DIFFRACTION |
| Resolution | 1.7 Å |
| Classification | HYDROLASE |
Sequence
Chain A (121 residues): Blast Uniprot EC 3.1.1.4SLLEFGKMILEETGKLAIPSYSSYGCYCGWGGKGTPKDATDRCCFVHDCCYGNLPDCNPKSDRYKYKRVNGAIVCEKGTS CENRICECDKAAAICFRQNLNTYSKKYMLYPDFLCKGELKCChain I (5 residues): Blast
FLAYK
User comments
Links
Search for 1tg4 in:
| Databases | Visualization tools | Analysis tools | Quarternary structure |
|---|---|---|---|
Categories: TG | PDB entry | X-RAY DIFFRACTION | HYDROLASE | 2004 | EC 3.1.1.4
