1tgr
From PDBWiki
Crystal Structure of mini-IGF-1(2)
| Authors | Yun, C.H. Tang, Y.H. Feng, Y.M. An, X.M. Chang, W.R. Liang, D.C. |
| Citation | 1.42A crystal structure of mini-IGF-1(2): an analysis of the disulfide isomerization property and receptor binding property of IGF-1 based on the three-dimensional structure PubMed |
| Release date | 2004-12-28 |
| Exp. Method | X-RAY DIFFRACTION |
| Resolution | 1.42 Å |
| Classification | HORMONE/GROWTH FACTOR |
Sequence
Chain A (52 residues): Blast UniprotGPETLCGAELVDALQFVCGDRGFYFNKPKAKGIVDECCFRSCDLRRLEMYCAChain B (52 residues): Blast Uniprot
GPETLCGAELVDALQFVCGDRGFYFNKPKAKGIVDECCFRSCDLRRLEMYCA
User comments
Links
Search for 1tgr in:
| Databases | Visualization tools | Analysis tools | Quarternary structure |
|---|---|---|---|

