1tmz

From PDBWiki

Authors	Greenfield, N.J. Montelione, G.T. Farid, R.S. Hitchcock-DeGregori, S.E.
Citation	The structure of the N-terminus of striated muscle alpha-tropomyosin in a chimeric peptide: nuclear magnetic resonance structure and circular dichroism studies. PubMed
Release date	2003-04-01
Exp. Method	NMR
Resolution	0.0 Å
Classification	TROPOMYOSIN

Sequence

Chain A (32 residues): Blast Uniprot

MDAIKKKMQMLKLDNYHLENEVARLKKLVGER

Chain B (32 residues): Blast Uniprot

MDAIKKKMQMLKLDNYHLENEVARLKKLVGER

User comments

Splice variants

This is one of the few examples where structures for different transcripts of the same protein are available:

ensembl transcript id	uniprot id	pdb code
ENSRNOT00000057641	TPM1_RAT	1ihq
ENSRNOT00000024575	TPM1_RAT	1mv4
ENSRNOT00000057641	TPM1_RAT	1tmz
ENSRNOT00000024575	TPM1_RAT	2b9c
ENSRNOT00000024575	TPM1_RAT	2g9j

See also [1]

• add comment

Links