1y8e
From PDBWiki
![]() |
VCP:Suramin Complex
| Authors | Ganesh, V.K. Muthuvel, S.K. Smith, S.A. Kotwal, G.J. Murthy, K.H. |
| Citation | Structural Basis for Antagonism by Suramin of Heparin Binding to Vaccinia Complement Protein. PubMed |
| Release date | 2005-08-23 |
| Exp. Method | X-RAY DIFFRACTION |
| Resolution | 2.2 Å |
| Classification | Viral protein |
Sequence
Chain(s) A B (244 residues): Blast UniprotCCTIPSRPINMKFKNSVETDANANYNIGDTIEYLCLPGYRKQKMGPIYAKCTGTGWTLFNQCIKRRCPSPRDIDNGQLDI GGVDFGSSITYSCNSGYHLIGESKSYCELGSTGSMVWNPEAPICESVKCQSPPSISNGRHNGYEDFYTDGSVVTYSCNSG YSLIGNSGVLCSGGEWSDPPTCQIVKCPHPTISNGYLSSGFKRSYSYNDNVDFKCKYGYKLSGSSSSTCSPGNTWKPELP KCVR
User comments
Evidence of falsification
"The University of Alabama at Birmingham has issued a statement indicating that a former UAB researcher may have fabricated or falsified data about protein structures that are contained in the Protein Data Bank.
The university did not include a name of the researcher, but the Birmingham News this week reported that the scientist is H.M. Krishna Murthy and an independent review by BioInform of the PDB shows that Murthy is associated with all of the proteins that UAB said were falsified.
The newspaper said that a probe of Murthy's research has been underway since 2007.
"After a thorough examination of the available data, which included a re-analysis of each structure alleged to have been fabricated, the committee found a preponderance of evidence that structures 1bef, 1cmw, 1df9/2qid, 1g40, 1g44, 1l6l, 2ou1, 1rid, 1y8e, 2a01, and 2hr0 were more likely than not falsified and/or fabricated and recommended that they be removed from the public record," the university said in its statement this week."
See also:
- http://www.genomeweb.com/informatics/university-alabama-says-researcher-fabricated-protein-structures-now-protein-dat
- http://main.uab.edu/Sites/reporter/articles/71570/
- http://blog.al.com/birmingham-news-stories/2009/12/ex-uab_researchers_work_may_be.html
Official statement of the wwPDB:
--Jmduarte 08:31, 10 December 2009 (EST)
Links
Search the pdb-l mailing list for discussions about '1y8e'
Search for 1y8e in:

