2a01

From PDBWiki

*Move mouse over for cartoon image*

Crystal Structure of Lipid-free Human Apolipoprotein A-I

Authors	Ajees, A.A. Anantharamaiah, G.M. Mishra, V.K. Hussain, M.M. Murthy, K.H.M.
Citation	Crystal structure of human apolipoprotein A-I: Insights into its protective effect against cardiovascular diseases. PubMed
Release date	2006-02-21
Exp. Method	X-RAY DIFFRACTION
Resolution	2.4 Å
Classification	LIPID TRANSPORT

Sequence

Chain(s) A B C (243 residues): Blast Uniprot

DEPPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGSALGKQLNLKLLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETE
GLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALR
THLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKL
NTQ

User comments

Evidence of falsification

"The University of Alabama at Birmingham has issued a statement indicating that a former UAB researcher may have fabricated or falsified data about protein structures that are contained in the Protein Data Bank.

The university did not include a name of the researcher, but the Birmingham News this week reported that the scientist is H.M. Krishna Murthy and an independent review by BioInform of the PDB shows that Murthy is associated with all of the proteins that UAB said were falsified.

The newspaper said that a probe of Murthy's research has been underway since 2007.

"After a thorough examination of the available data, which included a re-analysis of each structure alleged to have been fabricated, the committee found a preponderance of evidence that structures 1bef, 1cmw, 1df9/2qid, 1g40, 1g44, 1l6l, 2ou1, 1rid, 1y8e, 2a01, and 2hr0 were more likely than not falsified and/or fabricated and recommended that they be removed from the public record," the university said in its statement this week."