2eqf

Solution structure of the 7th A20-type zinc finger domain from human tumor necrosis factor, alpha-induced protein3

Authors	Zhang, H.P. Hayashi, F. Yokoyama, S.
Citation	Solution structure of the 7th A20-type zinc finger domain from human tumor necrosis factor, alpha-induced protein3
Release date	2007-10-02
Exp. Method	NMR
Resolution	0.0 Å
Classification	HYDROLASE

Sequence

Chain A (46 residues): Blast Uniprot EC 3.-.-.-

GSSGSSGPKQRCRAPACDHFGNAKCNGYCNECFQFKQMYGSGPSSG