2g9j
From PDBWiki
 |
Complex of TM1a(1-14)Zip with TM9a(251-284): a model for the polymerization domain ("overlap region") of tropomyosin, Northeast Structural Genomics Target OR9
| Authors | Greenfield, N.J. Huang, Y.J. Swapna, G.V. Bhattacharya, A. Rapp, B. Singh, A. Montelione, G.T. Hitchcock-Degregori, S.E. |
| Citation | Solution NMR Structure of the Junction between Tropomyosin Molecules: Implications for Actin Binding and Regulation. PubMed |
| Release date | 2006-11-07 |
| Exp. Method | SOLUTION NMR |
| Resolution | 0.0 Å |
| Classification | STRUCTURAL PROTEIN |
Sequence
Chain(s) C D (37 residues): Blast UniprotGCGKSIDDLEDELYAQKLKYKAISEELDHALKDMTSIChain(s) A B (33 residues): Blast Uniprot
GMDAIKKKMQMLKLDNYHLENEVARLKKLVGER
User comments
Splice variants
This is one of the few examples where structures for different transcripts of the same protein are available:
| ensembl transcript id | uniprot id | pdb code |
|---|---|---|
| ENSRNOT00000057641 | TPM1_RAT | 1ihq |
| ENSRNOT00000024575 | TPM1_RAT | 1mv4 |
| ENSRNOT00000057641 | TPM1_RAT | 1tmz |
| ENSRNOT00000024575 | TPM1_RAT | 2b9c |
| ENSRNOT00000024575 | TPM1_RAT | 2g9j |
See also [1]
Links
Search the pdb-l mailing list for discussions about '2g9j'
Search for 2g9j in:
