2jp7

NMR structure of the Mex67 UBA domain

Authors	Hobeika, M. Brockmann, C. Iglesias, N. Gwizdek, C. Neuhaus, D. Stutz, F. Stewart, M. Divita, G. Dargemont, C.
Citation	Coordination of Hpr1 and ubiquitin binding by the UBA domain of the mRNA export factor Mex67 PubMed
Release date	2007-08-14
Exp. Method	NMR
Resolution	0.0 Å
Classification	TRANSLATION

Sequence

Chain A (57 residues): Blast Uniprot

RLNPVQLELLNKLHLETKLNAEYTFMLAEQSNWNYEVAIKGFQSSMNGIPREAFVQF