2jsp

The prokaryotic Cys2His2 zinc finger adopts a novel fold as revealed by the NMR structure of A. tumefaciens Ros DNA binding domain

Authors	Malgieri, G. Russo, L. Esposito, S. Baglivo, I. Zaccaro, L. Pedone, E.M. Di Blasio, B. Isernia, C. Pedone, P.V. Fattorusso, R.
Citation	The prokaryotic Cys2His2 zinc-finger adopts a novel fold as revealed by the NMR structure of Agrobacterium tumefaciens Ros DNA-binding domain. PubMed
Release date	2008-01-22
Exp. Method	NMR
Resolution	0.0 Å
Classification	GENE REGULATION

Sequence

Chain A (87 residues): Blast Uniprot

AVNVEKQKPAVSVRKSVQDDHIVCLECGGSFKSLKRHLTTHHSMTPEEYREKWDLPVDYPMVAPAYAEARSRLAKEMGLG
QRRKANR