2jv1
From PDBWiki
NMR structure of human insulin monomer in 35% CD3CN zinc free, 50 structures
| Authors | Bocian, W. Sitkowski, J. Bednarek, E. Tarnowska, A. Kawecki, R. Kozerski, L. |
| Citation | Structure of human insulin monomer in water/acetonitrile solution. PubMed |
| Release date | 2008-01-08 |
| Exp. Method | NMR |
| Resolution | 0.0 Å |
| Classification | HORMONE |
Sequence
Chain A (21 residues): Blast UniprotGIVEQCCTSICSLYQLENYCNChain B (30 residues): Blast Uniprot
FVNQHLCGSHLVEALYLVCGERGFFYTPKT
User comments
Links
Search for 2jv1 in:
| Databases | Visualization tools | Analysis tools | Quarternary structure |
|---|---|---|---|
Categories: JV | PDB entry | NMR | HORMONE | HOMO SAPIENS | 2008 | PDB entry updated
