2om0
From PDBWiki
![]() |
Structure of human insulin in presence of urea at pH 6.5
| Authors | Norrman, M. Schluckebier, G. |
| Citation | Crystallographic characterization of two novel crystal forms of human insulin induced by chaotropic agents and a shift in pH. PubMed |
| Release date | 2007-12-04 |
| Exp. Method | X-RAY DIFFRACTION |
| Resolution | 2.05 Å |
| Classification | hormone |
Sequence
Chain(s) 1 3 A C E G I K Q S U X a c e g i k (21 residues): Blast UniprotGIVEQCCTSICSLYQLENYCNChain(s) 2 4 B D F H J L R T V Y b d f h j l (30 residues): Blast Uniprot
FVNQHLCGSHLVEALYLVCGERGFFYTPKT
User comments
Warning! There are more than 26 chains in this PDB entry!
Links
Search the pdb-l mailing list for discussions about '2om0'
Search for 2om0 in:

