2yts

Solution structure of the C2H2 type zinc finger (region 715-747) of human Zinc finger protein 484

Authors	Tochio, N. Tomizawa, T. Abe, H. Saito, K. Li, H. Sato, M. Koshiba, S. Kobayashi, N. Kigawa, T. Yokoyama, S.
Citation	Solution structure of the C2H2 type zinc finger (region 715-747) of human Zinc finger protein 484
Release date	2007-10-09
Exp. Method	NMR
Resolution	0.0 Å
Classification	TRANSCRIPTION

Sequence

Chain A (46 residues): Blast Uniprot

GSSGSSGTGEKPYICNECGKSFIQKSHLNRHRRIHTGEKPSGPSSG